PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G102900.1
Common NameB456_007G102900, LOC105802736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 315aa    MW: 34594.2 Da    PI: 9.9316
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G102900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.45.8e-1264108147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT +E ++++da +++  + Wk+I + +g  +t  q++s+ qky
  Gorai.007G102900.1  64 RESWTDQERDKFLDALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 108
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.32E-1558114IPR009057Homeodomain-like
PROSITE profilePS5129413.84859113IPR017930Myb domain
TIGRFAMsTIGR015576.6E-1762111IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.7E-663104IPR009057Homeodomain-like
SMARTSM007176.1E-1063111IPR001005SANT/Myb domain
PfamPF002491.6E-964108IPR001005SANT/Myb domain
CDDcd001671.25E-766109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVSVSPNPAP GFYFFDPMNM GLPGLSSLPP ANAVAPPPPP TAGSPYLEDP SKKIRKPYTI  60
TKSRESWTDQ ERDKFLDALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KAQKNGATEH  120
VPPPRPKRKA AHPYPQKAPK NAAVVPQVVG PFQSSSALLE SGYTYRPDSS SVLENPIAKG  180
AWSSRSYDSV PPVTVSQRTK DDATFAGPNI APNCCYSSSK ESTPRIWSFG KTIAQGDHRK  240
QSRVVPDFSQ VYTFLGSVFD PGASGHLQIL KQMDPINVEA VVVLMRNLAT NLKSPEFEDQ  300
RRLLSTYDAE SRGG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6151111e-125JX615111.1 Gossypium hirsutum clone NBRI_GE58935 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490010.10.0PREDICTED: protein REVEILLE 5
SwissprotC0SVG51e-105RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A0D2TCM60.0A0A0D2TCM6_G
STRINGPOPTR_0014s08520.11e-153(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.26e-91MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]